PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000121265
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 361aa    MW: 40485.2 Da    PI: 7.6001
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000121265genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.96.4e-56171421128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGfrFhPtdeel+++yL+kkv ++++++ +++ evd++k+ePw+Lp+k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke++s  
  MDP0000121265  17 LPPGFRFHPTDEELISHYLHKKVIDTSFSC-KAMGEVDLNKSEPWQLPRKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIYS-X 110
                    79****************************.88***************99999*****************************************.9 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++lvg+kktLvfykgrapkgek++Wvmheyrl
  MDP0000121265 111 KSLVGMKKTLVFYKGRAPKGEKSNWVMHEYRL 142
                    99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-6314167IPR003441NAC domain
PROSITE profilePS5100559.13517167IPR003441NAC domain
PfamPF023652.9E-2918142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MENVPAGIVE EDDQIDLPPG FRFHPTDEEL ISHYLHKKVI DTSFSCKAMG EVDLNKSEPW  60
QLPRKAKMGE KEWYFFCVRD RKYPTGLRTN RATEAGYWKA TGKDKEIYSX KSLVGMKKTL  120
VFYKGRAPKG EKSNWVMHEY RLDGKFSVHN LPKTAKNEWV ICRVFEKNSG GKKTHISGFV  180
TLASLGNEIG SSGLPPLMDS SPYSAPKAKP ASESHYVPCF SNPDPTDVQR NQGNIADYMN  240
NNPLFGVSSN SSNFFPRIPF PNSFYSAHNA PLSTSFKFPG SDILQDQSIL RALLENNAAN  300
MRQQSYKTER EPVSVSQETG LTSDMNAEIS SVMSNLEMAT RPYGDQDPPA AAAGLDNFWN  360
Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-5771735171NO APICAL MERISTEM PROTEIN
1ut4_B5e-5771735171NO APICAL MERISTEM PROTEIN
1ut7_A5e-5771735171NO APICAL MERISTEM PROTEIN
1ut7_B5e-5771735171NO APICAL MERISTEM PROTEIN
3swm_A6e-5771738174NAC domain-containing protein 19
3swm_B6e-5771738174NAC domain-containing protein 19
3swm_C6e-5771738174NAC domain-containing protein 19
3swm_D6e-5771738174NAC domain-containing protein 19
3swp_A6e-5771738174NAC domain-containing protein 19
3swp_B6e-5771738174NAC domain-containing protein 19
3swp_C6e-5771738174NAC domain-containing protein 19
3swp_D6e-5771738174NAC domain-containing protein 19
4dul_A5e-5771735171NAC domain-containing protein 19
4dul_B5e-5771735171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.169711e-135cell culture| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981280.0KF198128.1 Malus hupehensis NAC domain protein (NAC138) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008393174.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ21e-145NC100_ARATH; NAC domain-containing protein 100
TrEMBLS5RUX40.0S5RUX4_9R
STRINGPOPTR_0015s02170.11e-178(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-147NAC domain containing protein 100